PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G259800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family GRF
Protein Properties Length: 559aa    MW: 61247.9 Da    PI: 6.9163
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G259800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.21.6e-24182226145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Aqcoe6G259800.1.p 182 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEG 226
                        79****************************************985 PP

2QLQ62.79.5e-22113149137
                QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                        ++FT++Q+++L++Q+l+yKy++an+PvP++Ll +i+k
  Aqcoe6G259800.1.p 113 GPFTPSQWMELEHQALIYKYINANVPVPSNLLIPISK 149
                        59********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.8E-13113149IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.2E-16114147IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.39114149IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.663182226IPR014977WRC domain
PfamPF088796.5E-21183225IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MDNNKQERSF VGSVDDDWGN FNKMARVDDD DDFSTTTGSA SKTLLRDPCS SSLLRSNNVH  60
HQQMLSFSSP KPDSYSFTND FYHHALSTYA RNTGWGCGSL NTNMHGGLTG ARGPFTPSQW  120
MELEHQALIY KYINANVPVP SNLLIPISKA FNPSAFSAFS GSFRPNTLGW GSFHLGFSGN  180
NDPEPGRCRR TDGKKWRCSR DAVADQKYCE RHMNRGRHRS RKPVEGQTGH AAAGPAATKV  240
MAMCSGGGAS NSLPVTQHKV DSVQSNAADC SSHTHMNRKL PNNRSLGGRL QDSQGLSVLS  300
PAVNMTCKDT PFSNLKQHIP CEEATRQEFG FFSSVSLLNT SQRSSYIDCE NFGSTPDLNS  360
QESRVHDPLR HFIDDCPKNQ SDRSRIAWPE VEETQLDRTQ LSISIPMTSD FLSSLPTHDK  420
LALSPLRLSR EFDPVQMGLG VGSFPNEPTH RQVNWIPVAW ESSMGGPLGE VLNHTNNASG  480
DQKSTLSALN LMTEGWDGGL QMELSPTGVL QKTSFGSLSN SSTGSSPRAE TNQTLEEKSF  540
CDNFLNPTIV NSSTLLPL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273550.10.0PREDICTED: growth-regulating factor 6-like isoform X2
TrEMBLF6H1750.0F6H175_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g08650.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-102growth-regulating factor 1